PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009103068.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 408aa    MW: 46106.7 Da    PI: 5.5101
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009103068.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box26.81.1e-081357341
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41
                    +r C+ + + +++++C  ++ +lC++C +  H+       H++v 
  XP_009103068.1 13 ARACDSCVKRRARWYCAADDAFLCQSCDTLVHSAnllarrHERVL 57
                    578*****************************6688888898875 PP

2CCT68.12.3e-23350393144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk+a
  XP_009103068.1 350 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA 393
                     9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.4661158IPR000315B-box-type zinc finger
SMARTSM003361.9E-101158IPR000315B-box-type zinc finger
PfamPF006431.2E-71357IPR000315B-box-type zinc finger
CDDcd000212.32E-91458No hitNo description
PfamPF062036.7E-18350392IPR010402CCT domain
PROSITE profilePS5101716.083350392IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0016020Cellular Componentmembrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MKSLASAVGA KTARACDSCV KRRARWYCAA DDAFLCQSCD TLVHSANLLA RRHERVLLKS  60
ASKHSNHNHN HSPSSPPHEA ATWHHGFTRK PRTPRGSGKK NNLSIFHDLV PEISVEDQTE  120
SCELEEQLIC QVPVLDPTVA EQILNDVVEA KIEFPIMRSG VMMDDQEDED NAESCLNGFF  180
PTDMELEEYA ADVETLLGRG LDTESYAMEE LGLSNKEMFK IEKEEETKDM NIGICDDDRD  240
ATAPFELSFD YESHNTYEEE VIKNIEGSGE CVKVKEEEQK NVLMLRLNYD SVISTWGGQC  300
PPWTSGEPPE RDIDISNWPF VSMGGNVRES QQKHHVGVCL PSSGFGDGGR EARVSRYREK  360
RRTRLFSKKI RYEVRKLNAE KRPRMKGRFV KRASLAVSAM NSPLGVNY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1360376RRTRLFSKKIRYEVRKL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.161700.0flower| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894760.0AC189476.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB080N15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009103068.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16-like
SwissprotQ8RWD00.0COL16_ARATH; Zinc finger protein CONSTANS-LIKE 16
TrEMBLM4D7L50.0M4D7L5_BRARP; Uncharacterized protein
STRINGBra012475.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24672767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.10.0B-box type zinc finger protein with CCT domain